which structure is most likely found in green plants

Answers

Answer 1
The structure that is mostly found in green plants is chloroplast.

Related Questions

During the nitrogen cycle, through which structure are nitrogen compounds first absorb into the plant?.

Answers

Answer:

Plants take up nitrogen compounds through their roots. Animals obtain these compounds when they eat the plants. When plants and animals die or when animals excrete wastes, the nitrogen compounds in the organic matter re-enter the soil where they are broken down by microorganisms, known as decomposers

Answer:

the

Explanation:

What does the specific
defense of the immune
system use to fight
pathogens?
A. red blood cells
B. vaccines
C. lymphocytes
D. plasma

Answers

Answer:

C

Explanation:

There are different types of T-Cells, aka Lymphocytes.

the Cytotoxic T-Cells will find and directly attack, also giving them the name "Killer Cells"

The Cytotoxic cell's main purpose is to find bacteria, viruses, and cancer cells.

Next,

there is the Helper T Cells, which recruit other immune system cells and organize a special immune response.

Regulatory T cells, suppress the immune system so it doesn't overreact. Just as in Auto-Immune diseases

Sphingosine is not a component of:

Answers

According to the research, sphingosine is an aminoalcohol that forms ceramides and is not a component of cardiolipin.

What is sphingosine?

It is an aminoalcohol that is found in most of the sphingolipids of animal tissues.

It intervenes in cellular metabolic regulation processes related to lipid signaling pathways.

Therefore, we can conclude that according to the research, sphingosine is an aminoalcohol that forms ceramides and is not a component of cardiolipin.

Learn more about sphingosine here: https://brainly.com/question/13480753

#SPJ12

i need help with part b​

Answers

hey i can’t see the picture
89% for part 1, 0.9% on part 2. The reason for this is because only about 10% of energy makes it to the human because we lose ATP (energy) by simply trying to digest our meals. Same thing with the cow. The cow didn’t get the full 100% of the sun’s energy because it had to use energy to digest the plant.

The atlantic cod (gadus callarias) is a fish which lays about 5 000 000 eggs in its lifetime. On average, only two of these eggs survive to become adult cod. How does this promote evolution?

Answers

The atlantic cod (gadus callarias) is a fish which lays about 5 000 000 eggs in its lifetime. On average, only two of these eggs survive to become adult cod. This promote evolution because the environment selects the most evolved animals to survive that environment.

What is the evolutionary process?

Evolutionary processes aim, therefore, to generate greater adaptation of species in an environment. When new species of organisms are formed from gradual changes in preexisting species.

So although there are several eggs initially only those that survived the environment are able and evolved to reproduce, so the evolution of species is carried out.

See more about evolution of species at brainly.com/question/13194079

#SPJ12

When mpf activity declines in a normal healthy cell it is due to _____

Answers

When mpf activity declines in a normal healthy cell it is due to degradation of cyclin.

What is the cell cycle?

The cell cycle refers to the process by which new cells are formed by mitosis from an existing cells.

Several cell components are important in the cell cycle.

Cyclin is an important part involved in the cell cycle.

A decrease in cyclin due to increased degradation results in a decline in mpf activity.

Learn more about cell cycle at: https://brainly.com/question/8283140

#SPJ12

Round seeds are dominant over wrinkled seeds in
the pea plants that Mendel studied. Provide the
genotypes and phenotypes of offspring produced
when a heterozygous round plant crosses with
another heterozygous round plant.

Answers

Genotype - RR - 25%, Rr - 50%, rr - 25% (1:2:1)

Phenotype - Round seeds - 75%, Wrinkled seeds - 25% (3:1)

How explain your answer?

Let the letter "r" stand for the alleles, where R is round seeds and r is wrinkled seeds. A genotype is an individual's genes represented through alleles. Phenotypes are how the genes express themselves. In other words, genotypes will be written using letters, the alleles, and phenotypes will be the possible outcomes of the alleles.

Both of the parent seeds have the genotypes Rr and the phenotype of round seeds.

If you create punnet square (which had four boxes in total) 1 will have RR, 2 will have Rr, and 1 will have rr. These are the ratios for the genotypes. Each box represents 25%, so the percentages will be 25, 50, and 25. Finally, 3 of these boxes (RR and Rr) will result in round seeds because those are dominant. Only the genotype rr will result in wrinkled phenotype. Therefore, the ratio is 3:1 or 75% to 25%.

Thus, this could be the answer.

To learn more about genotypes and phenotypes click here:

https://brainly.com/question/20730322

#SPJ1

Which muscle contributes to external rotation of the glenohumeral joint?

Answers

According to the research, the infraspinatus contributes to external rotation of the glenohumeral joint.

What is the infraspinatus?

It is a flat muscle, which is part of the rotator cuff of the shoulder, it fulfills the function of stabilizing the joint surfaces involved in the glenohumeral joint, performing external rotation.

In other words, this muscle performs similar movements and shares the same place where they are inserted, with the supraspinatus, the teres minor and the subscapularis.

Therefore, we can conclude that according to the research, the infraspinatus contributes to external rotation of the glenohumeral joint.

Learn more about glenohumeral joint here: https://brainly.com/question/11501423

#SPJ12

Which phrase used by the president was specifically chosen to convince the public to support the war?

“facts of yesterday”
“unprovoked and dastardly attack”
“have already formed their opinions”
“a state of war has existed”

Answers

The phrase used by the president was specifically chosen to convince the public to support the war is “unprovoked and dastardly attack”. Thus, option "B" is correct.

How, support your answer?

President Roosevelt was in office when Pearl Harbor happened, and it was the perfect occasion that the government of the United States needed to enter a war that was clearly being won by the Germans and Japanese, they had already taken decisions prior to this to help the allies, but they couldn´t directly send troops when the bombings on Pearl Harbor took place, and since the USA had never provoked, attacked or done anything to upset Japan, they were now able to declare war on Japan an its allies.

Thus, option "B" is correct.

To learn more about President Roosevelt click here:

https://brainly.com/question/14014275

#SPJ1

Answer:

B

Explanation:

Did the assignment

Why did Gregor Mendel choose to use purebred plants in his experiments?
O They reproduce sexually.
O They exhibit only one form of a trait
O They have a variety of traits.
O They reproduce asexually,

Answers

Answer:

B: The exhibit only one form of a trait

Explanation:

Got it right on the Quiz.

They exhibit only one form of a trait

Which of the
following is the
correct pairing of
the cell type to its
purpose?
A. parenchyma cell-thin cell wall, perform
metabolic functions, and make up most of
the plant
B. sclerenchyma cell-strong cell walls that
support the plant and allow it to bend
C. collenchyma cells-thick, hard cell walls to
make it tough like a seed coat

Answers

The statement that correctly pairs the cell type and it's purpose is as follows: parenchyma cell - thin cell wall, perform metabolic functions, and make up most of the plant (option A).

What are the types of plant cells?

Plant cells are of varying types and they perform different functions in the system.

The simple cell types that can be found in plants are as follows:

Parenchyma; the cellular tissue, typically soft and succulent, found chiefly in the softer parts of leaves, pulp of fruits. Collenchyma; living, elongated, mechanical and flexible ground tissue with angular pectin depositions; present just under leaves, tendrils and stems Sclerenchyma; mechanical ground tissue, impermeable to water, which consists of cells having narrow lumen and thick, mineralized walls of lignin

From the above description, the statement that correctly pairs the cell type and it's purpose is as follows: parenchyma cell - thin cell wall, perform metabolic functions, and make up most of the plant.

Learn more about cell types at: https://brainly.com/question/15227816

#SPJ1

The primary mirror in a reflecting telescope is a

plane mirror.
concave mirror.
convex mirror.

Answers

concave mirror it is

Answer:

B or concave mirror.

Explanation:

Summary of transcription

Answers

Answer:

Explanation:

During transcription, DNA is converted into RNA in the nucleus of the cell.

Select the correct answer. A force of 15 newtons is applied to both Object A with a mass of 25 kilograms and Object B with a mass of 50 kilograms. What is true about the acceleration of Object A and Object B? A. Acceleration of Object A is four times that of the acceleration of Object B. B. Acceleration of Object A is the same as the acceleration of Object B. C. Acceleration of Object A is half the acceleration of Object B. D. Acceleration of Object A is twice that of the acceleration of Object B.

Answers

By Newton's second law

F=ma , F=force (unit= N)

m=mass (Kg), a=acceleration (m/s2)

By applying the formula, we can calculate acceleration

a = F/ m

For object A,

Force =15N, Mass=25kg

a= 15/25

acceleration, a=0.6m/s2

For object B,

Force=15N, Mass=50 kg

a=15/50

acceleration,a=0.3m/s2

By calculation, the acceleration of object A is twice the of object B.

To learn more about the force, mass and acceleration, you can refer to-

https://brainly.com/question/2059251

#SPJ10

Answer:

See image

Explanation:

Plato

Can you think of a physiologic process that is not under the control of a homeostatic reflex system?.

Answers

Hair and nail growth are not homeostatically controlled. There is no miracle in using exuberance to handle these procedures. The disadvantage is that they can produce very long and interrupt normal activities.

Hair and nail growth are not homeostatic ally controlled.  The disadvantage is that they can produce very long and interrupt normal activities.

What is homeostasis ?

It is a physiological process where body to maintain the internal environment in response to changes in outer external environment.

Internal environment means the interstitial fluids while external environment refers to the environment in which organisms live.

Any  fluctuation in homeostasis leads to death or a disease of an organism, called as homeostatic imbalance.

The diseases include diabetes, dehydration, hypoglycemia, hyperglycemia, gout etc.

The controlling factors of homeostasis are stimulus can be any physical, chemical or environmental factors  leads to deviation of normal body’s environment

Receptor receives the stimulus and pass to the control center like neuron.

Regulator can control coordinator center receives and processes information from the receptor like Hypothalamus.

Effector can control commands from stimulus like Glands, muscles

Response refers to any reaction response to the stimulus.

Learn more about  homeostasis , here:

https://brainly.com/question/3888340

#SPJ2

The "collar bone" is also known as the:

Answers

According to the research, the collar bone is also known as the clavicle.

What is the clavicle?

They are the bones of the human being that are found in the upper sector of the chest, articulating with the acromion of the shoulder blade and the sternum.

This bone is important for the composition of the shoulder joint complex, since it functions as a stabilizer for all parts of the shoulder, and therefore for the arm.

Therefore, we can conclude that according to the research, the collar bone is also known as the clavicle.

Learn more about the clavicle here: https://brainly.com/question/10843431

#SPJ12

Answer:

clavicle

Explanation:

hope this helps :)

What are the most primitive surviving vertebrates?

Answers

The most primitive surviving vertebrate are those in the Agnatha class.

Agnatha

This refers to a group of fishes that are jawless. They include lampreys and hagfishes.

Fishes in the Agnathan class have no fins nor stomachs.

Hagfishes still exist with over 76 species in different cold waters around the world.

Lampreys live mostly as parasites on other fishes and are found in the Atlantic oceans.

More on Agnatha can be found here: https://brainly.com/question/1675358

#SPJ12

5. How can we say that added sugar is not necessary for our health (it's not), when we learned that
aerobic cellular respiration uses glucose as a fuel source? (hint - where did hunter/gatherers our
ancestors, get sugar?)

Answers

Answer:

more than likely fruits and berries

or natural sugars

The body does not require any added sugar to stay healthy. Hunters/gatherers and our ancestors consumed fruits and milk that are natural sugar to obtain energy.

What is the difference between added sugar and natural sugar?Natural sugars are found in unprocessed food such as fruits and milk.Fruits contain fructose and milk contains lactose.On the other hand, added sugars are the artificial sweeteners that we often add to our daily diet in the form of white sugars and caloric sweeteners. From the perspective of health, it is always better to opt for natural sugar that keeps our body stable energy and stable metabolism.Added sugars are harmful when consumed in higher quantities.

Hence, added sugar is not necessary for our health when we have learned that aerobic cellular respiration uses glucose as a fuel source that can be obtained from natural sugar.

To learn more about natural sugars refer:

https://brainly.com/question/1723985

#SPJ2

If square is dominant over round, what are the phenotypes for the following genotypes?
SS
Ss
ss

Answers

Answer:

SS: square Ss: square ss: round

Explanation:

The dominant trait is the capital letter

Disavantages of carbon

Answers

Answer:

Disavantages if Carbon: Carbon can cause climate change by trapping heat, and they can contribute to respiratory disease from smog and air pollution.

which factor will mostly likely decrease biodiversity? complex population interactions introduced species increased energy availability narrower niches

Answers

The factor that mostly likely decrease biodiversity in a ecosystem is narrower niches because narrower niches does not give way for various organisms to inhabit .

What is biodiversity?

Biodiversity refer to various or different kind of plants and animals present in the environment and their role in their habitat

Therefore, The factor that mostly likely decrease biodiversity is narrower niches

because narrower niches does not give way for various organisms to inhabit.

Learn more about biodiversity below.

https://brainly.com/question/20935770

#SPJ11

What are the defining characteristics of chondricythyes?

Answers

Species in this class have paired fins, hard scales, a two-chambered heart, and a pair of nostrils. Most species have 5-7 gill slits on each side of their body.

Chondrichthyes are cartilaginous fishes and are mostly marine with basic fish attributes.

Chondrichthyes

They are a class of fishes known as cartilaginous fishes. They possess all the characteristics of fishes in addition to features such as:

living mostly in marine habitatspossessing a pair of jawthe central placement of the mouthpossession of cartilaginous skeletons instead of bones

More on Chondrichthyes can be found here: https://brainly.com/question/3520910

#SPJ12

from about 450 to 300 million years ago, ______ dominated earth's vegetation, and then about 300 million years ago, ______ began to become more prominent.

Answers

From about 450 to 300 million years ago, Bryophytes and seedless vascular plants dominated Earth's vegetation, and then about 300 million years ago, Gymnosperms began to become more prominent.

From about 450 to 300 million years ago, bryophytes dominated the earth's vegetation, and then about 300 million years ago, gymnosperms began to become more prominent.

Evolution of plants

About 450 to 300 million years ago, most of the plants as we currently have them are yet to evolve according to evolutionists.

Instead, seedless vascular plants such as bryophytes were around. Many years after, these seedless plants evolved into vascular plants with seeds that are not enclosed in fruits.

Vascular plants with seeds but without fruits are known as gymnosperms. Plants whose seeds are enclosed in fruits, angiosperms, evolved thereafter.

More on plant evolution can be found here: https://brainly.com/question/13492988

#SPJ11

In general, how might recombinant dna technology be used to prevent a genetic disorder caused by a mutation in a single gene?.

Answers

Recombinant DNA technology is used to prevent a genetic disorder caused by a mutation in a single gene by reinserting nucleotide sequences in a normal linear order.

What is a gene?

A gene is a fragment of single-stranded DNA that is used during transcription and translation to produce a protein.

A mutated gene has a different nucleotide sequence when compared to the normal gene, which can be corrected by using recombined normal sequences.

In conclusion, recombinant DNA technology is used to prevent a genetic disorder caused by a mutation in a single gene by reinserting nucleotide sequences in a normal linear order.

Learn more about recombinant DNA technology here:

https://brainly.com/question/5996835

#SPJ1

Which of these factors causes populations to compete?

A. Continuous migration
B. Low population densities
C. Limited resources
D. High death rates

Answers

C. Limited resources
Limited resources, this is because there is barely food, so the population will be competing for the food getting protective of their resources

Which does NOT describe bacteria? one niet
A They are prokaryotic cells.
B They have cell walls and cell membranes.
C Their genetic material is found in the cytoplasm.
D They have membrane-bound organelles.

Answers

Answer:

D they have membrane bound organelles

Explanation:

Sari and Jon disagree over who needs more calories (proportionately) per day to survive a three-month-old baby or a
grown adult San argues that a grown adult is bigger and needs more calories per pound of body weight Jon believes
the baby would require more calories per pound of body weight
he is most likely conect and why?
San, because it takes more energy to move the larger muscles that adults have, so they need more calories
Jon, because babies grow at a much berate than adults and require more cabries to support this growth
Jah, because babies are more active than grown adults and need more energy from calories
San because adults have more to do during the day and need more calories to sustain their activities

Answers

San is correct , because it takes more energy to move the larger muscles that adults and is denoted as option A.

What is Calorie?

This is referred to as a unit of energy in food substances such as carbohydrates, fats etc.

Adults have larger muscles composed of bigger tissues which requires more energy for their functioning in our daily activities which is why San was correct.

Read more about Calorie here https://brainly.com/question/1178789

#SPJ1

How many layers does a muscle fascicle have connective tissues

Answers

A muscle fascicle have three layers of connective tissues.

What are connective tissues?

Connective tissues are tissues which connects layers of organs or tissues together.

A muscle us a type of tissue.

A muscle fascicle have three layers of connective tissues called:

epimysium, perimysium, and endomysium

Therefore, a muscle fascicle have three layers of connective tissues.

Leran more about connective tissues at: https://brainly.com/question/408637

#SPJ12

An example of a wobble base is?​

Answers

Answer:

The four main wobble base pairs which are:

guanine–uracil (G–U),hypoxanthine–uracil (I–U), hypoxanthine–adenine (I–A), hypoxanthine–cytosine (I–C).

Choose any one of them.

Hypoxanthine uracil

Which of these statements is NOT true of the phylogenetic tree?

Answers

The statement that is not true of the phylogenetic tree is that it ranks organisms by importance in evolutionary history. option A

Features of the phylogenetic treeA phylogenetic tree is a diagram representing evolutionary relationships among organisms. It is also known as phylogenyPhylogenetic trees are hypothesesIt reflects how species or other groups evolved from a common ancestors.

Hence, the statement that is not true of the phylogenetic tree is that it ranks organisms by importance in evolutionary history. option A

The complete question is:

Which of these statements is NOT true of the phylogenetic tree?

A. It ranks organisms by importance in evolutionary history.

B. It depicts an organism's lineage as it changes over time.

C. It shows successive events of speciation in which one species gives rise to two.

Learn more about phylogenetic tree here:

https://brainly.com/question/2189834

#SPJ1

Other Questions
Give ur answer in standard form. 3 x 10^4 6 x 10^-4 Was the alleged misrepresentation the basis of or pivotal to your decision to attend the school?. 4. Write the function of a linear equation that includes thepoints (1,3) and (2,9). What is the annual effective absorbed dose equivalent limit for the general public (frequent exposure) PLEASE ANSWER ASAP!!!!!! WILL GIVE BRAINLIEST!!! The vertex of this parabola is at (3-2). When the value is 4 they-value is 3. What is the coefficient of the squared expression in theparabola's equation?A. 7B. 1C. -1D. 5 If f(x) = x + 8 and g(x) = 4x 3, find (f + g)(x). A. (f + g)(x) = 5x + 11 B. (f + g)(x) = 3x + 5 C. (f + g)(x) = 5x 11 D. (f + g)(x) = 3x 5 An architect is designing new housing structures for the primate section at the zoo. Her plan is shown below. Which animals will live in a building that is similar to the main primate house? A orangutans B chimpanzees C gibbons D gorillas What is a 10% margin increase on 1,810.69? How many grams of nitrogen,N2, would be required to react with6.25 moles hydrogen, H2? The Wilson family had 5 children. Assuming that the probability of a child being a girl is 0.5, find the probability that the Wilson family hadat least 3 girls? at most 3 girls? The quadrilateral below is formed from a parallelogram and anisosceles triangle.Calculate the size of angle VQU. read the direct speech below and complete the indirect reporting that f fllows question number 1 I overslept this morning La ltima frase nos desvela el suceso que est ocurriendo en el texto qu gran suceso es ese Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom describe the required qualifications occupation of dentist knowing that the client has two risk factors that cannot be modified, which intervention is most important for the nurse to include in the client's plan of care? Which of these was an accomplishment of the Han Dynasty?A.The invention of paper B. The discovery of a water passage to Europe C. The invention of the ballpoint pen D. The invention of the abacus A journey i have made A sequence is defined by the recursive function f(n + 1) = one-half(n). If f(3) = 9 , what is f(1) ?