Based on its prefix witch is the correct definition of impersonal

Answers

Answer 1
not personal

Explanation:

Such as dry twigs and branches. Based on its prefix, which is the correct definition of "impersonal"? not personal. Explanation -im means not.


Related Questions

In "Because I Could Not Stop for Death," what is the significance of the phrase “[Death] knew no haste”?
The phrase is meant to suggest the universality of Death’s power.
The phrase is evidence of the poet’s respect for Death’s grace and poise.
The phrase displays the poet’s frustration with Death’s lack of speed.
The phrase characterizes Death as being removed from human concerns.

Answers

Answer:

answer above is wrong lol

D: The phrase characterizes Death as being removed from human concerns.

Explanation:

edge 2022

In "Because I Could Not Stop for Death," the phrase "[Death] knew no haste" characterizes Death as being removed from human concerns; that is the last option, as the phrase suggests that Death is not bound by the temporal constraints that govern human life.

What is death?

The phrase "Death knew no haste" in Emily Dickinson's "Because I Could Not Stop for Death" is a significant one because it suggests that death is not subject to the temporal constraints that govern human life. The phrase creates the impression that death is patient, measured, and not subject to the hurry and urgency of human life. This characterization of death is consistent with the poem's overall tone, which is calm, reflective, and accepting of death's inevitability.

Hence, in "Because I Could Not Stop for Death," the phrase "[Death] knew no haste" characterizes Death as being removed from human concerns; that is the last option,

Learn more about the death here.

https://brainly.com/question/20411007

#SPJ5

Jeanne’s man struggle in the novel is growing up and finding her identity as both an American and as a Japanese person

Answers

Jeanne was a Japanese girl who struggled her life in America because of her different identity and her life during the war in America. Her one phase wanted to do anything so that he can fit in American lifestyle.

What is farewell to Manzar?

It is a memoir written by James D. Houston and Jeanne Wakatsuki Houston. The story is about the life of Jeanna. Her prewar life and postwar graduation.

Thus, the Jeanne was a Japanese girl who struggled with her identity in America and with living during the war there. Her one phase wanted to do all it took to have him blend in with American culture.

Learn more about farewell to Manzar

https://brainly.com/question/21289554

#SPJ1

topple v. fall down

synonyms – collapse, tumble

antonym – rise, stand, get up

Which word from the thesaurus entry could be used to replace the underlined word: "The building began to topple, brick by brick."

rise
collapse
stand
get up

Answers

Answer:

collapse

Explanation:

because topple means the building became unsteady and fell down slowly.

Which line from Sect. 39
reveals how Hawthorne
feels about Benjamin
Franklin?
A. So Sam called a constable, and
inquiries were set on foot to
discover the perpetrators of the
theft.
B.... it might have gone hard with
our friend Benjamin and his fellow-
laborers.
C. He therefore let the culprits off
pretty easily.

Answers

Answer:

B

Explanation:

It might have gone hard with our friend Benjamin and his fellow - laborers revealing how Hawthorne feels about Benjamin Franklin. Thus, option B is correct.

Who is Benjamin Franklin?

Franklin has been associated with writing both the American Government & the Declaration of Independence. He also worked on the Treaty of Paris, having put an end to the American War of Revolution over Britain.

But Hawthorne changes and criticizes that dream, illustrating the harsh truths of the outside world. Franklin shares his achievements and story to demonstrate to the American people that tenacity, intellect, and hard effort are the keys to success, whilst Hawthorne paints a grim picture of the world that awaits those who have lost their youth and their innocence.

Therefore, option B is correct.

Learn more about Benjamin Franklin, here:

https://brainly.com/question/4151265

#SPJ2

During a formal discussion in his science class, kai will be speaking about the importance of exercise. what is the best advice he can follow to be a prepared speaker? read the materials ahead of time and take notes about important ideas and viewpoints. read the materials again while others are talking and share ideas as they come to mind. listen to others as they speak and then form an opinion based on what they have to share. listen to others express facts and opinions and interrupt when someone makes a mistake.

Answers

During a formal discussion in his science class, kai will be speaking about the importance of exercise. 'Read the materials ahead of time and take notes about important ideas and viewpoints' is the best advice he can follow to be a prepared speaker.

What are the importance of exercises?

The importance of exercises are:

Helps to decrease the risk of heart diseasesHelps to maintain your weightReduce the risk of type 2 diabetes.

What are the types of exercise?

The types of exercise are:

Aerobic trainingStrength trainingFlexibility and mobility training

Hence, the correct answer is Option A

Learn more about importance of exercise on https://brainly.com/question/1744272

#SPJ10

Answer:

the answer is a or Read the materials ahead of time and take notes about important ideas and viewpoints.

Explanation:

I got a right

A time when u broke the rules

Answers

Answer:

when i went to school with slides on

Explanation:

When i stole a cookie from the cookie jar

INSTRUCTIONS: Determine the truthfulness of the material viewed by explaining what makes it true or false. Explain each in 2 to 3 sentences. (10 POINTS)

1-2._____________________________________________________________________________________________
__________________________________________________________________________________________________________________________________________________________________________________________________

3.-4._____________________________________________________________________________________________
__________________________________________________________________________________________________________________________________________________________________________________________________

5-6._____________________________________________________________________________________________
__________________________________________________________________________________________________________________________________________________________________________________________________

7-8._____________________________________________________________________________________________
__________________________________________________________________________________________________________________________________________________________________________________________________

9-10.____________________________________________________________________________________________
__________________________________________________________________________________________________________________________________________________________________________________________________

Answers

i don't know what time you are going home but i'm the first one thing is going


Which excerpt from The Odyssey best shows Odysseus demonstrating the epic hero traits of strength and
Leadership?

Answers

Answer:

the Lotus, or you lose your hope of home. '

Read the excerpt from "remembering to never forget: dominican republic’s ‘parsley massacre’" by mark memmott. passage a: this week, people from around the world are expected to gather in the dominican republic for a "border of lights" commemoration that aims to "honor a tragedy long forgotten, and unknown to many people." passage b: trujillo, as the border of lights website explains, fed and nurtured anti-haitian sentiment and created an atmosphere that still excludes ethnic haitians from becoming part of "the dominican melting pot." the method his soldiers used in 1937 to try to identify those who would be killed was cruelly unique. when confronting someone in the lands along the border with haiti, they would hold up a sprig of parsley and ask what it was. if the person responded by trilling the "r" in perejil (spanish for parsley), he would be free to go. anyone who didn't trill the "r" was thought to be a haitian creole speaker—and was likely to be killed. how do these excerpts work together to develop a central idea?

Answers

These excerpts work together to develop a central idea by discussing that Memmott explains that the tragedy is not well known today and then shows why it is worth remembering.

What is the summary of the Dominican republic’s ‘parsley massacre’?

Dominican soldiers mostly from distant parts of the nation flowed into the area Between October 2 and October 8. A cruel dictator in the Dominican Republic murdered hundreds of Haitians.

The Border of Lights ceremony is described in the first passage. Whereas second passage reflects the circumstances that gave rise to the beginning of this festival.

Learn more about the "parsley massacre", here:

https://brainly.com/question/13043319

#SPJ1

Answer:

D

Explanation:

I mean this is what I got. And it's right sooooo. I hope this helps. :))

Which events happen fist in edgar allan poe’s the black cat

Answers

Answer:

He starts abusing his wife and favorite cat, Pluto.

Explanation:

Answer:

echnically speaking, in Poe's story "The Black Cat " the first thing that 'happens' is that the narrator informs us he is going to die tomorrow and wishes to unburden his soul tonight by exposing "a series of household events" that have terrified, tortured, and destroyed him

"it is much safer to be feared
than loved."

Which type of evidence does Machiavelli
use to support his claim?

How does the author's use of this evidence create
meaning for the reader?

Answers

He uses logical evidence to support his claim and this creates a concrete and easily identifiable meaning for the reader.

What is logical evidence?It is a kind of proof for a statement.It is a fact that presents logical reasoning, showing something highly relatable to the reader.

Machiavelli claims it's better to be feared than loved because human beings are fake and love and admire other people only when it's convenient.

These characteristics of human beings are used to form the evidence in a very logical way, as it highlights easily identifiable reasoning and allows readers to recognize this type of behavior in themselves and the people around them.

Learn more about logical evidence at the link:

https://brainly.com/question/14046875

#SPJ1

Answer:

1.)logical

2.)by using a historical event to prove the claim

Explanation:

i got it right

PLEASE HELP
Read the excerpt from The Odyssey.

Now Zeus the lord of cloud roused in the north
a storm against the ships, and driving veils
of squall moved down like night on land and sea.
The bows went plunging at the gust; sails
cracked and lashed out strips in the big wind.
We saw death in that fury, dropped the yards,
unshipped the oars, and pulled for the nearest lee:
then two long days and nights we lay offshore
worn out and sick at heart, tasting our grief,
until a third Dawn came with ringlets shining.

What does this excerpt most suggest about the beliefs of the ancient Greeks?

1. They believed that nature’s strength was wholly uncontrollable.
2. They believed that nature’s wrath could never be overcome.
3. They believed that the gods were frequently unfair in their actions.
4. They believed that the gods often punished people for acting badly.

Answers

The excerpt from 'The Odyssey' suggests that the ancient Greeks believed that gods were frequently unfair in their actions.

What is 'The Odyssey'?

The Odyssey is a famous poem written by Homer, in which he has detailed about the beliefs of ancient Greeks by the way of using poetic devices.

In the excerpt given above, it can be understood that the Greeks often believed that the God's actions were unfair towards them.

Hence, option C holds true regarding 'The Odyssey'.

Learn more about 'The Odyssey' here:

https://brainly.com/question/394316

#SPJ1

News outlets have control over the arrangement of stories. For this reason, they can influence what the public thinks is important. Give two examples of how the media might do this.

Answers

People often have faith in the news media since they work so hard to inform the broader public or a specific audience. The goal of the news media is to convey to the public the news that has been obtained by the reporter.

What are the news control over the arrangement of stories?

The news should be communicated in a way that prevents people's perceptions from being impacted. People don't interact with the government directly.

Since only the media may engage with the government and serve as a vehicle for political socialization, information should always be verified in several different ways.

Thus, People often have faith in the news media since they work so hard to inform.


For more details about the news control over the arrangement, click here:

https://brainly.com/question/14892972

#SPJ1

Where should the quotation below be placed to further develop the paragraph?

One Greek scholar states, “The influence of the Olympians on everyday culture is equal to that of Shakespeare and the Bible” (Thomas 87).

Answers

The correct place to locate the quote from (Thomas 87) is before sentence number two (2).

How to identify the correct location of the appointment?

To identify the correct location of the quote, we must take into account that this quote is to support or argue a statement. Therefore, we must take into account the subject that is dealing with.

Based on the above, it can be inferred that the best placement for this quote is before sentence number two because it supports the above statement.

Note: This question is incomplete because there is some information missing. Here is the paragraph.

Read this student essay written about Greek mythology.

1. Greek mythology, though ancient, has a long-reaching influence upon modern life. 2. The US space program, for instance, is called Apollo, after the god who never missed a target and who ruled light. 3. Titanium, an elemental metal, is named after the Titans, who were locked far under the ground. 4. Even video games include characters such as Icarus and Kratos.

Learn more about citation in: https://brainly.com/question/1272936

#SPJ1

Study the editorial cartoon by Signé Wilkinson.
Copyright by Signe Wilkin
WILL WORK
for
AIR CONDITIONING!
23
Which details best support the purpose of this editorial
cartoon? Select three options.
the pattern of the woman's outfit
the "will work for air conditioning" sign
the rat sweating on the sidewalk
the city buildings and sidewalk
the comfortable man in the air-conditioned car

Answers

Answer:

b) the "will work for air conditioning" sign

c) the rat sweating on the sidewalk

e) the comfortable man in the air-conditioned car

Explanation:

The details in this cartoon demonstrate how individuals desire to either go to work for comfortable air-conditioning or work as a driver and remain in the air-conditioned car. The rat sweating on the pavement also needs air conditioning.

The buildings, walkways, and women's attire have nothing to do with air conditioning.

 

(See attached image)

Somebody help me with this question please thank you

Answers

C. instead

Explanation:

She chose to do something else "instead"

It is therefore because she was forced to change it because of not having the ingredients

The phrase “I suppose “ helps Roosevelt create which kind of tone

Answers

The phrase “I suppose “ helps Roosevelt create a Persuasive kind of tone.

Meaning of the phrase "I suppose"It comes from President Theodore Roosevelt during his speech.The origins of the rhetorical presidency and the idea of the executive as a bully pulpit were both inevitably influenced by Roosevelt's vision of the president as a steward of the people.Roosevelt introduced the rhetorical presidency; today's president makes use of popular rhetoric as one of his main methods of executive leadership.This has been a strategy utilized by every president since Roosevelt to sway and organize public opinion in their favor.

Hence, Roosevelt sets a persuasive tone with the words "I suppose."

To learn more about Theodore Roosevelt refer to:

https://brainly.com/question/8262673

#SPJ10

Question 1(Multiple Choice Worth 6 points) (LC) A Brief Study of Guts You may not know this, but you are home to a colony of bacteria. You may also not know it, but the health and happiness of that colony of bacteria have a direct effect on your own health and happiness. In short, if we are what we eat, then we may need to make bacteria part of our balanced breakfast. Microbes are single-celled organisms. They are literally everywhere. Microbes are in the air we breathe, on the surfaces of everything we touch, and inside our bodies. Microbes can be bacteria, fungi, protozoa, or viruses. A few years ago, scientists began studying the microbial life of our stomachs. Called The American Gut project, this study aims to understand the life of the bacteria that live in our digestive system. According to an article in the New York Times by Michael Pollan, the goal is to gather information on the types and amounts of bacteria in the human gut. Scientists want to describe what a normal healthy microbe and human relationship should look like inside our digestive system. While the research is still in the very early stages, scientists have learned the following: The strongest and healthiest microbe systems are those with a lot of variety. The guts of Americans have much less variety than the guts of other populations. Diets that include a lot of processed foods support less variation in bacteria. Studying the makeup of our individual bacteria communities will help scientists get a better idea of which bacteria help human bodies. We used to think that bacteria in our bodies were invaders. This new research suggests that bacteria are part of the protective army that keeps us healthy. In fact, our bodies have a hard time recovering from medicines like antibiotics because they disrupt the balance of helpful bacteria. It seems clear from the early evidence that living with bacteria helps us resist invasion from things that make us sick. Scientists have also learned that microbes might help our guts do things like process v

Answers

According to the information provided in "A Brief Study of Guts", the option that best summarizes what microbes can do for us is "They work to keep our bodies healthy and resistant to disease" (Option B).

What is a summary?

The concise version of story or text which highlights only the key points or ideas is referred to as a summary.

It is thus right to state that the option that best summarizes what microbes can do for us is "They work to keep our bodies healthy and resistant to disease"

See full question attached.

Learn more about summaries at:

https://brainly.com/question/25605883
#SPJ1

Answer:According to the information provided in "A Brief Study of Guts", the option that best summarizes what microbes can do for us is "They work to keep our bodies healthy and resistant to disease" (Option B).

What is a summary?

The concise version of story or text which highlights only the key points or ideas is referred to as a summary.

It is thus right to state that the option that best summarizes what microbes can do for us is "They work to keep our bodies healthy and resistant to disease

Eliza loves Christmas, and has seen the play and movie of Dickens "A Christmas Carol"
many times. Now, her teacher has asked her to prepare a report about the book. How
might her perspective affect her reaction to the book?

Answers

Answer:

Eliza may be biased about Scrooge's chsracter who hstes Christmas?

Read the excerpt from frederick douglass’s speech "what to the slave is the fourth of july?" go where you may, search where you will, roam through all the monarchies and despotisms of the old world, travel through south america, search out every abuse, and when you have found the last, lay your facts by the side of the everyday practices of this nation, and you will say with me, that, for revolting barbarity and shameless hypocrisy, america reigns without a rival. to support his purpose, douglass includes words such as .

Answers

To support his purpose, Douglass includes words such as "abuse," "barbarity" and "shameless" in this passage of his speech, as explained below.

What is Douglass' purpose?

In his speech "What to the Slave is the Fourth of July," Frederick Douglass has the purpose to lay bare the injustices and inequality in the United States.

In the particular passage we are analyzing here, Douglass accuses the country of being unrivaled when it comes to all the unfairness with which African Americans are treated. To support that, he uses words such as "abuse," "barbarity" and "shameless", which convey his disgust for the actions and attitude of the privileged classes.

With the information above in mind, we can say that Douglass uses the words "abuse," "barbarity" and "shameless" to support his purpose.

The answer choices for this question are the following:

"search," "roam," and "found""monarchies," "reigns," and "nation""abuse," "barbarity" and "shameless'"Old World," "South America," and "America"

Learn more about purpose here:

https://brainly.com/question/15632673

#SPJ1

Answer:

The answer is C. <3

I (do) this sort of work when I (be) an apprentice.

Answers

Answer:

I will do this sort of work when I am an apprentice.

Is this suppose to be in past participle or present?

Past: I did this sort of work when I was an apprentice

Read this excerpt of Walter's words to Mama from A Raisin in the Sun:
You run our lives like you want to. It was your money and
you did what you wanted with it. So what you need for me
to say it was all right for? (Bitterly, to hurt her as deeply as
he knows possible) So you butchered up a dream of mine
-you-who always talking 'bout your children's dreams...
What does this excerpt most reveal about Walter?
A. That he is confident he will come up with money for his business
B. That he is grateful for the way his parents raised him
C. That he feels like a failure as a man
D. That he respects Mama and her choices

Answers

The excerpt that most reveal about Walter is that he feels like a failure as a man. The correct option is C.

What is A Raisin in the Sun?

A Raisin in the Sun is a play about the discrimination in against African American people in America. It is a story of the time of 1950s in Chicago. This is a play written by Lorraine Hansberry.

Thus, the correct option is C. That he feels like a failure as a man.

Learn more about A Raisin in the Sun

https://brainly.com/question/3430448

#SPJ1

. Write an illustration paragraph about the grounds of your school or the view outside the window where you study (include at least three supporting sentences).

Answers

The grounds in my school is quite wide. It is sites on about 3 acres of land. Viewing it from outside the window, it is mostly filled with various sports sections such as basket ball,  and a lawn tennis. It also has  very park-like space where students can just sit and discuss or play.

What is a illustration paragraph?

An illustration paragraph is a paragraphs that seeks to describe an idea, or a thing.

In this case, the subject being illustrated and or described is the grounds of the school.

Learn more about illustration paragraphs at:
https://brainly.com/question/15214607
#SPJ1

QUICK PLEASE !!!!!!

Which excerpt from The Call of the Wild is an example of direct characterization?

“Dave refused to run quietly on the trail behind the sled, where the going was easy, but continued to flounder alongside in the soft snow, where the going was most difficult, till exhausted.”
“But Mercedes interfered, crying, ‘Oh, Hal, you mustn’t,’ as she caught hold of the whip and wrenched it from him. ‘The poor dears! Now you must promise you won’t be harsh with them for the rest of the trip, or I won’t go a step.’”
“‘Mush on, poor sore feets,’ the driver encouraged them as they tottered down the main street of Skaguay. ‘Dis is de las’. Den we get one long res’. Eh? For sure. One bully long res’.’”
“But the Outside dogs, though practically broken in since their landing, did not amount to much. Three were short-haired pointers, one was a Newfoundland, and the other two were mongrels of indeterminate breed.”

Answers

The correct option is A). “Dave refused to run quietly on the trail behind the sled, where the going was easy, but continued to flounder alongside in the soft snow, where the going was most difficult, till exhausted.

What is the summary of "The Call of the Wild"?

"The Call of the Wild" is based on author Jack London's and  Buck's true life experiences in the Yukon. It is based on real life history.

The story is about the dog named Buck, who was stolen from his home in California and sent to the Yukon. In the Yukon, Buck became friend with outdoorsman and started his new life filled with adventures.

Buck experiences the adventure of a lifetime as he ultimately finds his true place in the world.

Learn more about the "The Call of the Wild" here:-

https://brainly.com/question/3380167

#SPJ1

Which among the following has a negative connotation?
O Generous
O Spendthrift
Benevolent
O Philanthropic

Answers

Answer:

spendthrift

Explanation:

A spendthrift is a person who spends money in an irresponsible way, or in other words, wastes money.

The word "spendthrift" has a negative connotation because of the image of wastefulness attached to it.

The words "generous", "benevolent", and "philanthropic" are used to compliment people, and do not have any negative connotations.

Generous jabsbshshshsnjsushshwnsbsbshehwjwwnbwbsbsbsbssvvsbsvsbsbsbsbjskwiwhevdns

Who is not a capulet in romeo and juliet?

a. nurse
b. gregory
c. tybalt
d. abram

Answers

The answer is d.Abram

What are the parts of speech? How many are these? Write about each part in detail.

Answers

There are 8 part of speech this include

NounPronounVerbAdverbAdjectivePrepositionConjunctionInterjection

What are part of speech?

Part of speech are used to group words this is based on the classes the words belong to.

The class a particular word belongs to indicate the function of the word.

Therefore, Noun can be a name of a thing

Pronoun are used to identify a subject and verbs indicate actions in sentence.

Learn more on speech below,

https://brainly.com/question/721326

#SPJ1

Somebody help me with this question please thank you

Answers

An independent clause is also known as main clause

15. Read the sentence. I do not think the girls will be lost in the woods for too much longer. Which reading strategy is being described?A.make personal connections
B.ask questions
C.establish a purpose for reading
D.make predictions ​

Answers

D is correct. by saying they don’t think the girls will be lost much longer the person is predicting they will get out of it
D is the correct answer

B. Form verbs from the given abstract nouns:
fil
1. satisfactory
2. knowledge
3. punishment
4. marriage
5. silence
6. treatment
7. growth
8. agreement

Answers

Answer:

hope it will help good day

Other Questions
Was the alleged misrepresentation the basis of or pivotal to your decision to attend the school?. 4. Write the function of a linear equation that includes thepoints (1,3) and (2,9). What is the annual effective absorbed dose equivalent limit for the general public (frequent exposure) PLEASE ANSWER ASAP!!!!!! WILL GIVE BRAINLIEST!!! The vertex of this parabola is at (3-2). When the value is 4 they-value is 3. What is the coefficient of the squared expression in theparabola's equation?A. 7B. 1C. -1D. 5 If f(x) = x + 8 and g(x) = 4x 3, find (f + g)(x). A. (f + g)(x) = 5x + 11 B. (f + g)(x) = 3x + 5 C. (f + g)(x) = 5x 11 D. (f + g)(x) = 3x 5 An architect is designing new housing structures for the primate section at the zoo. Her plan is shown below. Which animals will live in a building that is similar to the main primate house? A orangutans B chimpanzees C gibbons D gorillas What is a 10% margin increase on 1,810.69? How many grams of nitrogen,N2, would be required to react with6.25 moles hydrogen, H2? The Wilson family had 5 children. Assuming that the probability of a child being a girl is 0.5, find the probability that the Wilson family hadat least 3 girls? at most 3 girls? The quadrilateral below is formed from a parallelogram and anisosceles triangle.Calculate the size of angle VQU. read the direct speech below and complete the indirect reporting that f fllows question number 1 I overslept this morning La ltima frase nos desvela el suceso que est ocurriendo en el texto qu gran suceso es ese Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom describe the required qualifications occupation of dentist knowing that the client has two risk factors that cannot be modified, which intervention is most important for the nurse to include in the client's plan of care? Which of these was an accomplishment of the Han Dynasty?A.The invention of paper B. The discovery of a water passage to Europe C. The invention of the ballpoint pen D. The invention of the abacus A journey i have made A sequence is defined by the recursive function f(n + 1) = one-half(n). If f(3) = 9 , what is f(1) ? Add.(3+x3+3x2)+(2x324x2)Express the answer in standard form.Enter your answer in the box.